Contacte-nos

Pessoa de Contato : Qin

Número de telefone : +86 13663845045

Whatsapp : +8613663845045

Free call

Hidrocloro farmacêutico 16941-32-5 do Glucagon do Peptide branco do pó

Quantidade de ordem mínima : 10 G Preço : Negotiable
Tempo de entrega : dia 1-2works Termos de pagamento : L/C, D/A, D/P, T/T, Western Union, MoneyGram
Habilidade da fonte : 100kg/month
Lugar de origem: China Marca: Filter
Número do modelo: 16789-98-3

Informação detalhada

Pureza: >98% Cor: Branco
Forma: CAS: 16789-98-3
Realçar:

matérias primas farmacêuticas

,

esteroides dos laboratórios do pharma

Descrição de produto

 

 

Hidrocloro intermediário farmacêutico 16941-32-5 do Glucagon do Peptide do pó da fonte do laboratório

 

 

Detalhes do produto:

 

Nome do produto: Glucagon
Sinônimos: GLUCAGON 1-37; GLUCAGON (1-37) (SUÍNO); GLUCAGON 37; ACETATO DO GLUCAGON; HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA; H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH; OXYNTOMODULIN (SUÍNO); OXYNTOMODULIN
CAS: 16941-32-5
MF: C153H225N43O49S
MW: 3482,75
EINECS: 232-708-2
Categorias de produto: Derivados do ácido aminado; Peptide; Biologia de célula estaminal de GlucagonIslet; Diferenciação de célula estaminal da ilhota; Hormonas; Outras hormonas da proteína/Peptide; Glucagon e Glucagon-como PeptidesPeptides para a biologia celular; Biologia de célula estaminal de GlucagonsIslet; Fatores de crescimento de Cytokines e hormonas (obesidade); Peptides gastrintestinais; Pesquisa de GlucagonObesity; API; Pesquisa do diabetes
Pureza: 98%.99%
Estrutura molecular  

 

Hidrocloro farmacêutico 16941-32-5 do Glucagon do Peptide branco do pó 0


Que é acetato do Glucagon?

O Glucagon é uma hormona do peptide, produzida por pilhas alfa do pâncreas, que levanta a concentração de glicose na circulação sanguínea. Seu efeito é oposto àquele de, que abaixa a concentração da glicose. O pâncreas libera o glucagon quando a concentração de glicose na circulação sanguínea cai demasiado baixo. O Glucagon faz com que o fígado converta o glycogen armazenado na glicose, que é liberada na circulação sanguínea. Os níveis altos da glicemia estimulam a liberação de. permite que a glicose sejam pegados e - os tecidos dependentes perto usados. Assim, o glucagon e a insulina são parte de um sistema de feedback que mantenha níveis da glicemia a nível estável. O Glucagon pertence a uma família de diversas outras hormonas relacionadas.

 

Breve introdução:
1. o Somatostatin tem dois formulários ativos produzidos pela segmentação alternativa de um único preproprotein: um de 14 ácidos aminados, os outro de 28 ácidos aminados.

2. Em todos os animais vertebrados, existe seis genes diferentes do somatostatin que foram nomeados SS1, SS2, SS3, SS4, SS5, e SS6. Os seis genes diferentes junto com os cinco receptors diferentes do somatostatin permitem que o somatostatin possua uma grande escala das funções. Os seres humanos têm somente um gene do somatostatin, SST.

 

Estratégias do empacotamento & da entrega:

Suficiente estoque.
Agente logístico sofisticado e profissional.
Equipe de embalagem bem treinada e disciplinada. Maneiras originais e discretos de enviar ao mesmo tempo 2 mg/vial a 20mg/vial a seu destino. As expedições rápidas e discretos podiam ser arranjadas para a passagem de alfândega garantida.
As imagens da embalagem e o código tachear são fornecidos dentro de 12 horas após ter recebido o pagamento.
A informação de seguimento Updated será fornecida cada outro dia.
Serviço excelente da após-venda: Todas as perguntas ou problemas após ter recebido o produto, sentem por favor livres contactar-nos.

 

Personalização dos produtos:

1. 0.5mg CJC com DAC + 0.5mg

2. Ipamorelin de Hexarelin+1mg

3. Ghrp-6 1mg+Ipamorelin

4. 1mg+Cjc-12951mg+MGf 500mcg

Nós podemos misturar polipeptídeos diferentes de acordo com sua exigência.

 

Você pode estar nesses
Entre em contato conosco

Incorpore sua mensagem

13663845045@163.com
+8613663845045
+86 13663845045
+86 13663845045